PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004493026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB
Protein Properties Length: 605aa    MW: 68406.9 Da    PI: 4.4259
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004493026.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.2e-1776123148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+ Ed +lv++v+++G g+W+++ + +g+ R++k+c++rw ++l
   XP_004493026.1  76 KGSWTPAEDAILVEYVQKYGEGNWSAVQKIFGLARCGKSCRLRWTNHL 123
                      799******************************************996 PP

2Myb_DNA-binding431e-13129172146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++++T+eE++ll++ + +l ++ W++Ia  ++ gRt++++k++w++
   XP_004493026.1 129 KDAFTAEEEKLLIEQHYLLRNK-WSRIALSLP-GRTDNEIKNYWHT 172
                      679*******************.*********.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.2271127IPR017930Myb domain
SuperFamilySSF466897.49E-2973170IPR009057Homeodomain-like
SMARTSM007173.5E-1575125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2377130IPR009057Homeodomain-like
CDDcd001671.61E-1278123No hitNo description
PfamPF139213.8E-1679140No hitNo description
PROSITE profilePS5129416.926128178IPR017930Myb domain
SMARTSM007173.6E-12128176IPR001005SANT/Myb domain
CDDcd001678.66E-10131172No hitNo description
Gene3DG3DSA:1.10.10.605.2E-20131176IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MSSISKKDEG GKIVQPSRSL ESPEDDNCKT VKLKRSRPFS PEVTVNGGSQ PSVSAEEADN  60
DNRDNIEGGG DGNLKKGSWT PAEDAILVEY VQKYGEGNWS AVQKIFGLAR CGKSCRLRWT  120
NHLRPDLRKD AFTAEEEKLL IEQHYLLRNK WSRIALSLPG RTDNEIKNYW HTRVKRMKKA  180
GLPIYPEEIV QRANNMNQDH LNDDVVANQN DDDSQRENFE IPDVVFKSFK LCPDAIVLPP  240
QLNMQGSGLV DQNIDSIYNI LFVPPSKRAR LEDTTFNRPD NYTSNAAAIP VFDKCENYCM  300
LSPSPSDSIL DNSDQFHEDD DNLTVDNHEH DDNLTFDHHA LNNISSSEPI YDGCMRNELP  360
SFQNLETQQC SLDMPASRFP LHESVDASIQ FPPIEDSNQS ILYPDNRGPL NTTSSFHNHS  420
NGTNLQEGME RTALNEAFKS STYNAYEESS AQFMSSDYNN NHISMFSMAE SYSYPLETPD  480
GYGGINQNAQ FIDNSFINGD LDQLNLTHQD ALPDFNSHYI IQNAQLIDNS FMHGDLNQLN  540
FTAHSSMVGS LNQIDLAHHL SNFNAPGINQ NTFNQFTDGY LNQDLTQADD FSWCRYISEP  600
NTEYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29701761106B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004493026.10.0PREDICTED: uncharacterized protein LOC101510675
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.12e-54myb domain protein 101